Lineage for d1paga_ (1pag A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1441678Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 1441679Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 1441680Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 1441763Protein Pokeweed antiviral protein alpha [56385] (1 species)
  7. 1441764Species Pokeweed (Phytolacca americana) [TaxId:3527] [56386] (7 PDB entries)
  8. 1441776Domain d1paga_: 1pag A: [42208]
    complexed with fmp

Details for d1paga_

PDB Entry: 1pag (more details), 2.8 Å

PDB Description: the 2.5 angstroms structure of pokeweed antiviral protein
PDB Compounds: (A:) pokeweed antiviral protein

SCOPe Domain Sequences for d1paga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1paga_ d.165.1.1 (A:) Pokeweed antiviral protein alpha {Pokeweed (Phytolacca americana) [TaxId: 3527]}
vntiiynvgsttiskyatflndlrneakdpslkcygipmlpntntnpkyvlvelqgsnkk
titlmlrrnnlyvmgysdpfetnkcryhifndisgterqdvettlcpnansrvskninfd
sryptleskagvksrsqvqlgiqildsnigkisgvmsftekteaefllvaiqmvseaarf
kyienqvktnfnrafnpnpkvlnlqetwgkistaihdakngvlpkplelvdasgakwivl
rvdeikpdvallnyvggscqtt

SCOPe Domain Coordinates for d1paga_:

Click to download the PDB-style file with coordinates for d1paga_.
(The format of our PDB-style files is described here.)

Timeline for d1paga_: