Lineage for d1paga_ (1pag A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2999974Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2999975Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2999976Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 3000062Protein Pokeweed antiviral protein alpha [56385] (1 species)
  7. 3000063Species Pokeweed (Phytolacca americana) [TaxId:3527] [56386] (7 PDB entries)
  8. 3000074Domain d1paga_: 1pag A: [42208]
    complexed with fmp

Details for d1paga_

PDB Entry: 1pag (more details), 2.8 Å

PDB Description: the 2.5 angstroms structure of pokeweed antiviral protein
PDB Compounds: (A:) pokeweed antiviral protein

SCOPe Domain Sequences for d1paga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1paga_ d.165.1.1 (A:) Pokeweed antiviral protein alpha {Pokeweed (Phytolacca americana) [TaxId: 3527]}
vntiiynvgsttiskyatflndlrneakdpslkcygipmlpntntnpkyvlvelqgsnkk
titlmlrrnnlyvmgysdpfetnkcryhifndisgterqdvettlcpnansrvskninfd
sryptleskagvksrsqvqlgiqildsnigkisgvmsftekteaefllvaiqmvseaarf
kyienqvktnfnrafnpnpkvlnlqetwgkistaihdakngvlpkplelvdasgakwivl
rvdeikpdvallnyvggscqtt

SCOPe Domain Coordinates for d1paga_:

Click to download the PDB-style file with coordinates for d1paga_.
(The format of our PDB-style files is described here.)

Timeline for d1paga_: