Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) |
Family c.66.1.53: TrmB-like [142647] (2 proteins) Pfam PF02390 |
Protein automated matches [422073] (1 species) not a true protein |
Species Bacillus subtilis [TaxId:224308] [422074] (1 PDB entry) |
Domain d7nyba_: 7nyb A: [422075] automated match to d2fcaa1 protein/RNA complex; complexed with sam |
PDB Entry: 7nyb (more details), 2.5 Å
SCOPe Domain Sequences for d7nyba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7nyba_ c.66.1.53 (A:) automated matches {Bacillus subtilis [TaxId: 224308]} waddflaenadiaisnpadykgkwntvfgndnpihievgtgkgqfisgmakqnpdinyig ielfksvivtavqkvkdseaqnvkllnidadtltdvfepgevkrvylnfsdpwpkkrhek rrltyshflkkyeevmgkggsihfktdnrglfeyslksfseygllltyvsldlhnsnleg nimteyeekfsalgqpiyraevewrt
Timeline for d7nyba_: