Lineage for d1pafb_ (1paf B:)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families) 
Family d.165.1.1: Plant cytotoxins [56372] (11 proteins) 
Protein Pokeweed antiviral protein alpha [56385] (1 species) Species Pokeweed (Phytolacca americana) [TaxId:3527] [56386] (7 PDB entries) 
Domain d1pafb_: 1paf B: [42207]
Details for d1pafb_
PDB Entry: 1paf (more details), 2.5 Å
PDB Description: the 2.5 angstroms structure of pokeweed antiviral protein
SCOP Domain Sequences for d1pafb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pafb_ d.165.1.1 (B:) Pokeweed antiviral protein alpha {Pokeweed (Phytolacca americana)}
vntiiynvgsttiskyatflndlrneakdpslkcygipmlpntntnpkyvlvelqgsnkk
titlmlrrnnlyvmgysdpfetnkcryhifndisgterqdvettlcpnansrvskninfd
sryptleskagvksrsqvqlgiqildsnigkisgvmsftekteaefllvaiqmvseaarf
kyienqvktnfnrafnpnpkvlnlqetwgkistaihdakngvlpkplelvdasgakwivl
rvdeikpdvallnyvggscqtt
SCOP Domain Coordinates for d1pafb_:
Click to download the PDB-style file with coordinates for d1pafb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pafb_:
- d1pafb_ appears in SCOP 1.57
- d1pafb_ appears in the current release, SCOPe 2.08
View in 3D
