Lineage for d7mzkc_ (7mzk C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2739519Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2742100Protein automated matches [190119] (24 species)
    not a true protein
  7. 2742214Species Human (Homo sapiens) [TaxId:9606] [188740] (709 PDB entries)
  8. 3085747Domain d7mzkc_: 7mzk C: [422064]
    Other proteins in same PDB: d7mzka1, d7mzka2, d7mzkb1, d7mzkb2, d7mzkd1, d7mzkd2, d7mzke1, d7mzke2, d7mzkh_, d7mzkl_, d7mzkm_, d7mzkn_
    automated match to d6txzi_
    complexed with cit, gol, mpd

Details for d7mzkc_

PDB Entry: 7mzk (more details), 2.25 Å

PDB Description: sars-cov-2 receptor binding domain bound to fab wcsl 129 and fab pdi 96
PDB Compounds: (C:) WCSL 129 heavy chain

SCOPe Domain Sequences for d7mzkc_:

Sequence, based on SEQRES records: (download)

>d7mzkc_ b.1.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqllesggglvqpggslrlscaasgftfsrfamtwvrqapgkglewvsaisgsggstyy
adsvkgrftisrdnskntlylqmnslraedtavyycakvgwgafdiwgqgtmvtvssast
kgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssgly
slssvvtvpssslgtqtyicnvnhkpsntkvdkkvepks

Sequence, based on observed residues (ATOM records): (download)

>d7mzkc_ b.1.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evqllesggglvqpggslrlscaasgftfsrfamtwvrqapgkglewvsaisgsggstyy
adsvkgrftisrdnskntlylqmnslraedtavyycakvgwgafdiwgqgtmvtvssast
kgpsvfplapsgtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglyslssvv
tvpssslgtqtyicnvnhkpsntkvdkkvepks

SCOPe Domain Coordinates for d7mzkc_:

Click to download the PDB-style file with coordinates for d7mzkc_.
(The format of our PDB-style files is described here.)

Timeline for d7mzkc_:

  • d7mzkc_ is new in SCOPe 2.08-stable