Lineage for d1pafa_ (1paf A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1939585Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 1939586Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 1939587Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 1939672Protein Pokeweed antiviral protein alpha [56385] (1 species)
  7. 1939673Species Pokeweed (Phytolacca americana) [TaxId:3527] [56386] (7 PDB entries)
  8. 1939683Domain d1pafa_: 1paf A: [42206]

Details for d1pafa_

PDB Entry: 1paf (more details), 2.5 Å

PDB Description: the 2.5 angstroms structure of pokeweed antiviral protein
PDB Compounds: (A:) pokeweed antiviral protein

SCOPe Domain Sequences for d1pafa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pafa_ d.165.1.1 (A:) Pokeweed antiviral protein alpha {Pokeweed (Phytolacca americana) [TaxId: 3527]}
vntiiynvgsttiskyatflndlrneakdpslkcygipmlpntntnpkyvlvelqgsnkk
titlmlrrnnlyvmgysdpfetnkcryhifndisgterqdvettlcpnansrvskninfd
sryptleskagvksrsqvqlgiqildsnigkisgvmsftekteaefllvaiqmvseaarf
kyienqvktnfnrafnpnpkvlnlqetwgkistaihdakngvlpkplelvdasgakwivl
rvdeikpdvallnyvggscqtt

SCOPe Domain Coordinates for d1pafa_:

Click to download the PDB-style file with coordinates for d1pafa_.
(The format of our PDB-style files is described here.)

Timeline for d1pafa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pafb_