Lineage for d1qcia_ (1qci A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1681140Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 1681141Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 1681142Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 1681225Protein Pokeweed antiviral protein alpha [56385] (1 species)
  7. 1681226Species Pokeweed (Phytolacca americana) [TaxId:3527] [56386] (7 PDB entries)
  8. 1681231Domain d1qcia_: 1qci A: [42201]
    protein/RNA complex; complexed with ade

Details for d1qcia_

PDB Entry: 1qci (more details), 2 Å

PDB Description: low temperature structure of pokeweed antiviral protein complexed with adenine
PDB Compounds: (A:) pokeweed antiviral protein

SCOPe Domain Sequences for d1qcia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcia_ d.165.1.1 (A:) Pokeweed antiviral protein alpha {Pokeweed (Phytolacca americana) [TaxId: 3527]}
vntiiynvgsttiskyatflndlrneakdpslkcygipmlpntntnpkyvlvelqgsnkk
titlmlrrnnlyvmgysdpfetnkcryhifndisgterqdvettlcpnansrvskninfd
sryptleskagvksrsqvqlgiqildsnigkisgvmsftekteaefllvaiqmvseaarf
kyienqvktnfnrafnpnpkvlnlqetwgkistaihdakngvlpkplelvdasgakwivl
rvdeikpdvallnyvggscqtt

SCOPe Domain Coordinates for d1qcia_:

Click to download the PDB-style file with coordinates for d1qcia_.
(The format of our PDB-style files is described here.)

Timeline for d1qcia_: