SCOPe 2.08: Domain d1qcgb_: 1qcg B:

Lineage for d1qcgb_ (1qcg B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)

6. Protein Pokeweed antiviral protein alpha [56385] (1 species)

7. Species Pokeweed (Phytolacca americana) [TaxId:3527] [56386] (7 PDB entries)

8. Domain d1qcgb_: 1qcg B: [42200]

Details for d1qcgb_

PDB Entry: 1qcg, 2.1 Å

PDB Description: low temperature structure of pokeweed antiviral protein

PDB Compounds: (B:) pokeweed antiviral protein

SCOPe Domain Sequences for d1qcgb_:

Sequence; same for both SEQRES and ATOM records:

>d1qcgb_ d.165.1.1 (B:) Pokeweed antiviral protein alpha {Pokeweed (Phytolacca americana) [TaxId: 3527]}
vntiiynvgsttiskyatflndlrneakdpslkcygipmlpntntnpkyvlvelqgsnkk
titlmlrrnnlyvmgysdpfetnkcryhifndisgterqdvettlcpnansrvskninfd
sryptleskagvksrsqvqlgiqildsnigkisgvmsftekteaefllvaiqmvseaarf
kyienqvktnfnrafnpnpkvlnlqetwgkistaihdakngvlpkplelvdasgakwivl
rvdeikpdvallnyvggscqtt

Timeline for d1qcgb_:

• d1qcgb_ first appeared (with stable ids) in SCOP 1.55
  
• d1qcgb_ appears in SCOPe 2.07