Lineage for d1abra_ (1abr A:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 513915Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 513916Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families) (S)
  5. 513917Family d.165.1.1: Plant cytotoxins [56372] (15 proteins)
  6. 513918Protein Abrin A-chain [56383] (1 species)
  7. 513919Species Abrus precatorius [TaxId:3816] [56384] (1 PDB entry)
  8. 513920Domain d1abra_: 1abr A: [42196]
    Other proteins in same PDB: d1abrb1, d1abrb2

Details for d1abra_

PDB Entry: 1abr (more details), 2.14 Å

PDB Description: crystal structure of abrin-a

SCOP Domain Sequences for d1abra_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1abra_ d.165.1.1 (A:) Abrin A-chain {Abrus precatorius}
edrpikfstegatsqsykqfiealrerlrgglihdipvlpdpttlqernryitvelsnsd
tesievgidvtnayvvayragtqsyflrdapssasdylftgtdqhslpfygtygdlerwa
hqsrqqiplglqalthgisffrsggndneekartliviiqmvaeaarfryisnrvrvsiq
tgtafqpdaamislennwdnlsrgvqesvqdtfpnqvtltnirnepvivdslshptvavl
almlfvcnppn

SCOP Domain Coordinates for d1abra_:

Click to download the PDB-style file with coordinates for d1abra_.
(The format of our PDB-style files is described here.)

Timeline for d1abra_: