Lineage for d2mlla_ (2mll A:)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1939585Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 1939586Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 1939587Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 1939659Protein Mistletoe lectin I A-chain [56381] (1 species)
  7. 1939660Species European mistletoe (Viscum album) [TaxId:3972] [56382] (11 PDB entries)
    different sequence variants
    Uniprot P81446 1-249
    Uniprot Q6ITZ3 1-240
  8. 1939670Domain d2mlla_: 2mll A: [42195]
    Other proteins in same PDB: d2mllb1, d2mllb2
    complexed with nag

Details for d2mlla_

PDB Entry: 2mll (more details), 2.7 Å

PDB Description: mistletoe lectin i from viscum album
PDB Compounds: (A:) protein (ribosome-inactivating protein type II)

SCOPe Domain Sequences for d2mlla_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mlla_ d.165.1.1 (A:) Mistletoe lectin I A-chain {European mistletoe (Viscum album) [TaxId: 3972]}
yergdldvtaqttgagyfsfitllrdyvssgsfsnaipllsqsggggeagrfvlveltns
ggdgitvaidvtnlyvvayqagsqsyflsgpggrggftgttrsslpfngsypdleqyggq
rkqiplgidqliqsvtalkfpgstrtgarsililiqmiseaarfnpilwrarqyinsgas
flpdvymleletswgqqstqvqhstdgvfnnpialadpgggvtltnvrdviaslaimlfv
c

SCOPe Domain Coordinates for d2mlla_:

Click to download the PDB-style file with coordinates for d2mlla_.
(The format of our PDB-style files is described here.)

Timeline for d2mlla_: