SCOPe 2.05: Domain d2mlla_: 2mll A:

Lineage for d2mlla_ (2mll A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)

6. Protein Mistletoe lectin I A-chain [56381] (1 species)

7. Species European mistletoe (Viscum album) [TaxId:3972] [56382] (11 PDB entries)
   different sequence variants
   Uniprot P81446 1-249
   Uniprot Q6ITZ3 1-240

8. Domain d2mlla_: 2mll A: [42195]
   Other proteins in same PDB: d2mllb1, d2mllb2
   complexed with nag

Details for d2mlla_

PDB Entry: 2mll, 2.7 Å

PDB Description: mistletoe lectin i from viscum album

PDB Compounds: (A:) protein (ribosome-inactivating protein type II)

SCOPe Domain Sequences for d2mlla_:

Sequence; same for both SEQRES and ATOM records:

>d2mlla_ d.165.1.1 (A:) Mistletoe lectin I A-chain {European mistletoe (Viscum album) [TaxId: 3972]}
yergdldvtaqttgagyfsfitllrdyvssgsfsnaipllsqsggggeagrfvlveltns
ggdgitvaidvtnlyvvayqagsqsyflsgpggrggftgttrsslpfngsypdleqyggq
rkqiplgidqliqsvtalkfpgstrtgarsililiqmiseaarfnpilwrarqyinsgas
flpdvymleletswgqqstqvqhstdgvfnnpialadpgggvtltnvrdviaslaimlfv
c

Timeline for d2mlla_:

• d2mlla_ first appeared (with stable ids) in SCOP 1.55
  
• d2mlla_ appears in SCOPe 2.04
  
• d2mlla_ appears in SCOPe 2.06
  
• d2mlla_ appears in the current release, SCOPe 2.08