Lineage for d7jpdc1 (7jpd C:3-324)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2776025Protein automated matches [190291] (19 species)
    not a true protein
  7. 2776134Species Influenza A virus [TaxId:641501] [256167] (2 PDB entries)
  8. 3085631Domain d7jpdc1: 7jpd C:3-324 [421948]
    Other proteins in same PDB: d7jpda2, d7jpdb2, d7jpdc2, d7jpdd_, d7jpde2, d7jpdf2
    automated match to d3ztna_
    complexed with bma, edo, iod, man, nag

Details for d7jpdc1

PDB Entry: 7jpd (more details), 2.95 Å

PDB Description: crystal structure of the trimeric full length mature hemagglutinin from influenza a virus a/fort monmouth/1/1947
PDB Compounds: (C:) Hemagglutinin HA1 chain

SCOPe Domain Sequences for d7jpdc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d7jpdc1 b.19.1.2 (C:3-324) automated matches {Influenza A virus [TaxId: 641501]}
dticigyhannstdtvdtvleknvtvthsvnlledshngklcrlkgiaplqlgkcniagw
ilgnpecesllskrswsyiaetpnsengtcypgdfadyeelreqlssvssferfeifpke
rswpkhnitrgvtaacshagkssfyknllwltetngsypklsksyvnnkekevlvlwgvh
hpsniedqktlyrkenayvsvvssnynrrftpeiaerpkvrgqagrmnyywtllepgdti
ifeangnliapwyafalsrgfgsgiitsnasmdecdtkcqtpqgainsslpfqnihpvti
gecpkyvkstklrmvtglrnip

SCOPe Domain Coordinates for d7jpdc1:

Click to download the PDB-style file with coordinates for d7jpdc1.
(The format of our PDB-style files is described here.)

Timeline for d7jpdc1:

  • d7jpdc1 is new in SCOPe 2.08-stable