![]() | Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
![]() | Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) |
![]() | Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families) ![]() |
![]() | Family d.165.1.1: Plant cytotoxins [56372] (11 proteins) |
![]() | Protein Mistletoe lectin I A-chain [56381] (1 species) |
![]() | Species European mistletoe (Viscum album) [TaxId:3972] [56382] (2 PDB entries) |
![]() | Domain d1ce7a_: 1ce7 A: [42194] Other proteins in same PDB: d1ce7b1, d1ce7b2 |
PDB Entry: 1ce7 (more details), 2.7 Å
SCOP Domain Sequences for d1ce7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ce7a_ d.165.1.1 (A:) Mistletoe lectin I A-chain {European mistletoe (Viscum album)} yergdldvtaqttgagyfsfitllrdyvssgsfsnaipllsqsggggeagrfvlveltns ggdgitvaidvtnlyvvayqagsqsyflsgpggrhgftgttrsslpfngsypdleqyggq rkqiplgidqliqsvtalkfpgstrtgarsililiqmiseaarfnpilwrarqyinsgas flpdvymleletswgqqstqvqhstdgvfnnpialadpgggvtltnvrdviaslaimlfv c
Timeline for d1ce7a_: