SCOPe 2.08: Domain d7jttb_: 7jtt B:

Lineage for d7jttb_ (7jtt B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214

4. Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families)

5. Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (9 proteins)

6. Protein Tryptophan synthase, beta-subunit [53688] (4 species)

7. Species Salmonella typhimurium [TaxId:90371] [53689] (66 PDB entries)

8. Domain d7jttb_: 7jtt B: [421925]
   Other proteins in same PDB: d7jtta_
   automated match to d6xe3b_
   complexed with cl, cs, dms, edo, f9f, kou, peg; mutant

Details for d7jttb_

PDB Entry: 7jtt, 1.64 Å

PDB Description: the external aldimine crystal structure of salmonella typhimurium tryptophan synthase mutant beta-s377a in complex f9 inhibitor at the alpha-site and cesium ion at the metal coordination site. the single beta-q114 rotamer conformation allows a hydrogen bond to form with the plp oxygen at the position 3 in the ring

PDB Compounds: (B:) tryptophan synthase beta chain

SCOPe Domain Sequences for d7jttb_:

Sequence; same for both SEQRES and ATOM records:

>d7jttb_ c.79.1.1 (B:) Tryptophan synthase, beta-subunit {Salmonella typhimurium [TaxId: 90371]}
ttllnpyfgefggmyvpqilmpalnqleeafvsaqkdpefqaqfadllknyagrptaltk
cqnitagtrttlylkredllhggahktnqvlgqallakrmgkseiiaetgagqhgvasal
asallglkcriymgakdverqspnvfrmrlmgaevipvhsgsatlkdacnealrdwsgsy
etahymlgtaagphpyptivrefqrmigeetkaqildkegrlpdaviacvgggsnaigmf
adfindtsvgligvepgghgietgehgaplkhgrvgiyfgmkapmmqtadgqieesysis
agldfpsvgpqhaylnsigradyvsitddealeafktlcrhegiipalesshalahalkm
mreqpekeqllvvnlagrgdkdiftvhdilkargei

Timeline for d7jttb_:

• d7jttb_ is new in SCOPe 2.08-stable