SCOPe 2.08: Domain d7eqdm_: 7eqd M:

Lineage for d7eqdm_ (7eqd M:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (17 species)
   not a true protein

7. Species Rhodospirillum rubrum [TaxId:269796] [421922] (1 PDB entry)

8. Domain d7eqdm_: 7eqd M: [421923]
   Other proteins in same PDB: d7eqd0_, d7eqd1_, d7eqd2_, d7eqd3_, d7eqd4_, d7eqd5_, d7eqd6_, d7eqd7_, d7eqd8_, d7eqd9_, d7eqda_, d7eqdb_, d7eqdd_, d7eqde_, d7eqdf_, d7eqdg_, d7eqdi_, d7eqdj_, d7eqdk_, d7eqdn_, d7eqdo_, d7eqdp_, d7eqdq_, d7eqdr_, d7eqds_, d7eqdt_, d7eqdu_, d7eqdv_, d7eqdw_, d7eqdx_, d7eqdy_, d7eqdz_
   automated match to d6z5rm_
   complexed with 07d, 08i, cdl, crt, fe, lmt, pef, pgv, rq0, u10

Details for d7eqdm_

PDB Entry: 7eqd, 2.76 Å

PDB Description: structure of photosynthetic lh1-rc super-complex of rhodospirillum rubrum

PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d7eqdm_:

Sequence; same for both SEQRES and ATOM records:

>d7eqdm_ f.26.1.1 (M:) automated matches {Rhodospirillum rubrum [TaxId: 269796]}
eyqniltgvqvrtaphsapiakgifprlgkpgfsywlgkigdaqigpiylgttgvlslvf
gffaieiigfnllasvnwspmefgrqffwlgleppaaeyglgfaplaeggwwqiagfflt
tsillwwvrmyrraralkmgthtawafasaiflflslgfirpllmgnfsesvpfgifphl
ewtnsfslnygnffynpfhmlsiaflygsallfamhgatilavsrlggdreveqitdrgt
aaeraalfwrwtmgfnatmesihrwawwfavlctftgaigilltgtvvdnwfewgvkhgl
apap

Timeline for d7eqdm_:

• d7eqdm_ is new in SCOPe 2.08-stable