Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) contains mixed beta-sheet |
Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) |
Family d.165.1.1: Plant cytotoxins [56372] (18 proteins) |
Protein Beta-momorcharin [56379] (1 species) (almost) identical with the anti-tumor and anti-HIV-1 protein MAP30 |
Species Bitter gourd (Momordica charantia) [TaxId:3673] [56380] (2 PDB entries) |
Domain d1cf5b_: 1cf5 B: [42192] |
PDB Entry: 1cf5 (more details), 2.55 Å
SCOPe Domain Sequences for d1cf5b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cf5b_ d.165.1.1 (B:) Beta-momorcharin {Bitter gourd (Momordica charantia) [TaxId: 3673]} dvnfdlstataktytkfiedfratlpfshkvydipllystisdsrrfillnltsyayeti svaidvtnvyvvayrtrdvsyffkesppeaynilfkgtrkitlpytgnyenlqtaahkir enidlglpalssaittlfyynaqsapsallvliqttaeaarfkyierhvakyvatnfkpn laiislenqwsalskqiflaqnqggkfrnpvdlikptgqrfqvtnvdsdvvkgnikllln srastaden
Timeline for d1cf5b_: