Lineage for d1f8qa_ (1f8q A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 613902Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 613903Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families) (S)
  5. 613904Family d.165.1.1: Plant cytotoxins [56372] (15 proteins)
  6. 613908Protein alpha-Momorcharin (momordin) [56377] (1 species)
  7. 613909Species Bitter gourd (Momordica charantia) [TaxId:3673] [56378] (8 PDB entries)
  8. 613916Domain d1f8qa_: 1f8q A: [42189]
    complexed with ccn, man, nag, ptd, xys

Details for d1f8qa_

PDB Entry: 1f8q (more details), 2.2 Å

PDB Description: crystal structure of alpha-momorcharin in acetonitrile-water mixture

SCOP Domain Sequences for d1f8qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f8qa_ d.165.1.1 (A:) alpha-Momorcharin (momordin) {Bitter gourd (Momordica charantia)}
dvsfrlsgadprsygmfikdlrnalpfrekvyniplllpsvsgagryllmhlfnrdgkti
tvavdvtnvyimgyladttsyffnepaaelasqyvfrdarrkitlpysgdyerlqiaagk
prekipiglpaldsaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pslatislenswsglskqiqlaqgnngifrtpivlvdnkgnrvqitnvtskvvtsniqll
lntrni

SCOP Domain Coordinates for d1f8qa_:

Click to download the PDB-style file with coordinates for d1f8qa_.
(The format of our PDB-style files is described here.)

Timeline for d1f8qa_: