Lineage for d1mom__ (1mom -)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 85384Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
  4. 85385Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families) (S)
  5. 85386Family d.165.1.1: Plant cytotoxins [56372] (11 proteins)
  6. 85390Protein alpha-Momorcharin (momordin) [56377] (1 species)
  7. 85391Species Bitter gourd (Momordica charantia) [TaxId:3673] [56378] (8 PDB entries)
  8. 85397Domain d1mom__: 1mom - [42188]

Details for d1mom__

PDB Entry: 1mom (more details), 2.16 Å

PDB Description: crystal structure of momordin, a type i ribosome inactivating protein from the seeds of momordica charantia

SCOP Domain Sequences for d1mom__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mom__ d.165.1.1 (-) alpha-Momorcharin (momordin) {Bitter gourd (Momordica charantia)}
dvsfrlsgadprsygmfikdlrnalpfrekvyniplllpsvsgagryllmhlfnydgkti
tvaldvtnvyimgyladttsyffnepaaelasqyvfrdarrkitlpysgnyerlqiaagk
prekipiglpaldsaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pslatislenswsglskqiqlaqgnngifrtpivlvdnkgnrvqitnvtskvvtsniqll
lntrni

SCOP Domain Coordinates for d1mom__:

Click to download the PDB-style file with coordinates for d1mom__.
(The format of our PDB-style files is described here.)

Timeline for d1mom__: