Lineage for d1ahaa_ (1aha A:)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1441678Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 1441679Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 1441680Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 1441687Protein alpha-Momorcharin (momordin) [56377] (1 species)
  7. 1441688Species Bitter gourd (Momordica charantia) [TaxId:3673] [56378] (8 PDB entries)
  8. 1441694Domain d1ahaa_: 1aha A: [42187]
    complexed with ade

Details for d1ahaa_

PDB Entry: 1aha (more details), 2.2 Å

PDB Description: the n-glycosidase mechanism of ribosome-inactivating proteins implied by crystal structures of alpha-momorcharin
PDB Compounds: (A:) alpha-momorcharin

SCOPe Domain Sequences for d1ahaa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahaa_ d.165.1.1 (A:) alpha-Momorcharin (momordin) {Bitter gourd (Momordica charantia) [TaxId: 3673]}
dvsfrlsgadprsygmfikdlrnalpfrekvyniplllpsvsgagryllmhlfnydgkti
tvavdvtnvyimgyladttsyffnepaaelasqyvfrdarrkitlpysgnyerlqiaagk
prekipiglpaldsaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pslatislenswsglskqiqlaqgnngifrtpivlvdnkgnrvqitnvtskvvtsniqll
lntrni

SCOPe Domain Coordinates for d1ahaa_:

Click to download the PDB-style file with coordinates for d1ahaa_.
(The format of our PDB-style files is described here.)

Timeline for d1ahaa_: