Lineage for d1mrh__ (1mrh -)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families) 
Family d.165.1.1: Plant cytotoxins [56372] (11 proteins) 
Protein alpha-Momorcharin (momordin) [56377] (1 species) Species Bitter gourd (Momordica charantia) [TaxId:3673] [56378] (8 PDB entries) 
Domain d1mrh__: 1mrh - [42186]
Details for d1mrh__
PDB Entry: 1mrh (more details), 2 Å
PDB Description: studies on crystal structures active center geometry and depurine mechanism of two ribosome-inactivating proteins
SCOP Domain Sequences for d1mrh__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mrh__ d.165.1.1 (-) alpha-Momorcharin (momordin) {Bitter gourd (Momordica charantia)}
dvsfrlsgadprsygmfikdlrnalpfrekvyniplllpsvsgagryllmhlfnrdgkti
tvavdvtnvyimgyladttsyffnepaaelasqyvfrdarrkitlpysgdyerlqiaagk
prekipiglpaldsaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pslatislenswsglskqiqlaqgnngifrtpivlvdnkgnrvqitnvtskvvtsniqll
lntrni
SCOP Domain Coordinates for d1mrh__:
Click to download the PDB-style file with coordinates for d1mrh__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mrh__:
- d1mrh__ first appeared (with stable ids) in SCOP 1.55
- d1mrh__ appears in SCOP 1.59
- d1mrh__ appears in the current release, SCOPe 2.08, called d1mrha_
View in 3D