Lineage for d1mrh__ (1mrh -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 37111Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
  4. 37112Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families) (S)
  5. 37113Family d.165.1.1: Plant cytotoxins [56372] (11 proteins)
  6. 37117Protein alpha-Momorcharin (momordin) [56377] (1 species)
  7. 37118Species Bitter gourd (Momordica charantia) [TaxId:3673] [56378] (8 PDB entries)
  8. 37122Domain d1mrh__: 1mrh - [42186]

Details for d1mrh__

PDB Entry: 1mrh (more details), 2 Å

PDB Description: studies on crystal structures active center geometry and depurine mechanism of two ribosome-inactivating proteins

SCOP Domain Sequences for d1mrh__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mrh__ d.165.1.1 (-) alpha-Momorcharin (momordin) {Bitter gourd (Momordica charantia)}
dvsfrlsgadprsygmfikdlrnalpfrekvyniplllpsvsgagryllmhlfnrdgkti
tvavdvtnvyimgyladttsyffnepaaelasqyvfrdarrkitlpysgdyerlqiaagk
prekipiglpaldsaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pslatislenswsglskqiqlaqgnngifrtpivlvdnkgnrvqitnvtskvvtsniqll
lntrni

SCOP Domain Coordinates for d1mrh__:

Click to download the PDB-style file with coordinates for d1mrh__.
(The format of our PDB-style files is described here.)

Timeline for d1mrh__: