Lineage for d7f65a2 (7f65 A:352-574)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
sandwich; 9 strands in 2 sheets; jelly-rollSuperfamily b.18.1: Galactose-binding domain-like [49785] (35 families) 
Family b.18.1.0: automated matches [191481] (1 protein)
not a true familyProtein automated matches [190770] (51 species)
not a true protein
Species Rhodococcus sp. [TaxId:104109] [232531] (10 PDB entries) 
Domain d7f65a2: 7f65 A:352-574 [421851]
Other proteins in same PDB: d7f65a1
automated match to d1ju3a1
complexed with bez, so4; mutant
Details for d7f65a2
PDB Entry: 7f65 (more details), 2.2 Å
PDB Description: bacetrial cocaine esterase with mutations t172r/g173q/v116k/s117a/a51l, bound to benzoic acid
PDB Compounds: (A:) cocaine esteraseSCOPe Domain Sequences for d7f65a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d7f65a2 b.18.1.0 (A:352-574) automated matches {Rhodococcus sp. [TaxId: 104109]}
plpdtaytpfylggsgaantstgggtlstsisgtesadtylydpadpvpslggtllfhng
dngpadqrpihdrddvlcystevltdpvevtgtvsarlfvsssavdtdftaklvdvfpdg
raialcdgivrmryretlvnptlieageiyevaidmlatsnvflpghrimvqvsssnfpk
ydrnsntggviareqleemctavnrihrgpehpshivlpiikr
SCOPe Domain Coordinates for d7f65a2:
Click to download the PDB-style file with coordinates for d7f65a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d7f65a2:
- d7f65a2 is new in SCOPe 2.08-stable
View in 3D
