SCOP 1.59: Domain d1ahb__: 1ahb -

Lineage for d1ahb__ (1ahb -)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (2 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (11 proteins)

6. Protein alpha-Momorcharin (momordin) [56377] (1 species)

7. Species Bitter gourd (Momordica charantia) [TaxId:3673] [56378] (8 PDB entries)

8. Domain d1ahb__: 1ahb - [42185]

Details for d1ahb__

PDB Entry: 1ahb, 2.2 Å

PDB Description: the n-glycosidase mechanism of ribosome-inactivating proteins implied by crystal structures of alpha-momorcharin

SCOP Domain Sequences for d1ahb__:

Sequence; same for both SEQRES and ATOM records:

>d1ahb__ d.165.1.1 (-) alpha-Momorcharin (momordin) {Bitter gourd (Momordica charantia)}
dvsfrlsgadprsygmfikdlrnalpfrekvyniplllpsvsgagryllmhlfnydgkti
tvavdvtnvyimgyladttsyffnepaaelasqyvfrdarrkitlpysgnyerlqiaagk
prekipiglpaldsaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pslatislenswsglskqiqlaqgnngifrtpivlvdnkgnrvqitnvtskvvtsniqll
lntrni

Timeline for d1ahb__:

• d1ahb__ first appeared (with stable ids) in SCOP 1.55
  
• d1ahb__ appears in SCOP 1.57
  
• d1ahb__ appears in SCOP 1.61
  
• d1ahb__ appears in the current release, SCOPe 2.08, called d1ahba_