SCOPe 2.08: Domain d1ahba_: 1ahb A:

Lineage for d1ahba_ (1ahb A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
   contains mixed beta-sheet

4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families)

5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)

6. Protein alpha-Momorcharin (momordin) [56377] (1 species)

7. Species Bitter gourd (Momordica charantia) [TaxId:3673] [56378] (10 PDB entries)

8. Domain d1ahba_: 1ahb A: [42185]
   complexed with fmp

Details for d1ahba_

PDB Entry: 1ahb, 2.2 Å

PDB Description: the n-glycosidase mechanism of ribosome-inactivating proteins implied by crystal structures of alpha-momorcharin

PDB Compounds: (A:) alpha-momorcharin

SCOPe Domain Sequences for d1ahba_:

Sequence; same for both SEQRES and ATOM records:

>d1ahba_ d.165.1.1 (A:) alpha-Momorcharin (momordin) {Bitter gourd (Momordica charantia) [TaxId: 3673]}
dvsfrlsgadprsygmfikdlrnalpfrekvyniplllpsvsgagryllmhlfnydgkti
tvavdvtnvyimgyladttsyffnepaaelasqyvfrdarrkitlpysgnyerlqiaagk
prekipiglpaldsaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pslatislenswsglskqiqlaqgnngifrtpivlvdnkgnrvqitnvtskvvtsniqll
lntrni

Timeline for d1ahba_:

• d1ahba_ first appeared (with stable ids) in SCOP 1.55, called d1ahb__
  
• d1ahba_ appears in SCOPe 2.07