Lineage for d1ahba_ (1ahb A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. Protein alpha-Momorcharin (momordin) [56377] (1 species)
  7. Species Bitter gourd (Momordica charantia) [TaxId:3673] [56378] (10 PDB entries)
  8. Domain d1ahba_: 1ahb A: [42185]
    complexed with fmp

Details for d1ahba_

PDB Entry: 1ahb (more details), 2.2 Å

PDB Description: the n-glycosidase mechanism of ribosome-inactivating proteins implied by crystal structures of alpha-momorcharin
PDB Compounds: (A:) alpha-momorcharin

SCOPe Domain Sequences for d1ahba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ahba_ d.165.1.1 (A:) alpha-Momorcharin (momordin) {Bitter gourd (Momordica charantia) [TaxId: 3673]}
dvsfrlsgadprsygmfikdlrnalpfrekvyniplllpsvsgagryllmhlfnydgkti
tvavdvtnvyimgyladttsyffnepaaelasqyvfrdarrkitlpysgnyerlqiaagk
prekipiglpaldsaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pslatislenswsglskqiqlaqgnngifrtpivlvdnkgnrvqitnvtskvvtsniqll
lntrni

SCOPe Domain Coordinates for d1ahba_ are not available.

Timeline for d1ahba_: