Lineage for d1mrga_ (1mrg A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2999974Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
    contains mixed beta-sheet
  4. 2999975Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) (S)
  5. 2999976Family d.165.1.1: Plant cytotoxins [56372] (18 proteins)
  6. 2999983Protein alpha-Momorcharin (momordin) [56377] (1 species)
  7. 2999984Species Bitter gourd (Momordica charantia) [TaxId:3673] [56378] (10 PDB entries)
  8. 2999987Domain d1mrga_: 1mrg A: [42183]
    complexed with adn

Details for d1mrga_

PDB Entry: 1mrg (more details), 1.8 Å

PDB Description: studies on crystal structures active center geometry and depurine mechanism of two ribosome-inactivating proteins
PDB Compounds: (A:) alpha-momorcharin

SCOPe Domain Sequences for d1mrga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mrga_ d.165.1.1 (A:) alpha-Momorcharin (momordin) {Bitter gourd (Momordica charantia) [TaxId: 3673]}
dvsfrlsgadprsygmfikdlrnalpfrekvyniplllpsvsgagryllmhlfnrdgkti
tvavdvtniyimgyladttsyffnepaaelasqyvfrdarrkitlpysgdyerlqiaagk
prekipiglpaldsaistllhydstaaagallvliqttaeaarfkyieqqiqerayrdev
pslatislenswsglskqiqlaqgnngifrtpivlvdnkgnrvqitnvtskvvtsniqll
lntrni

SCOPe Domain Coordinates for d1mrga_:

Click to download the PDB-style file with coordinates for d1mrga_.
(The format of our PDB-style files is described here.)

Timeline for d1mrga_: