Lineage for d7ew9a_ (7ew9 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867983Protein automated matches [190047] (37 species)
    not a true protein
  7. 2868094Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries)
  8. 3085510Domain d7ew9a_: 7ew9 A: [421827]
    Other proteins in same PDB: d7ew9b2
    automated match to d5us4a_
    complexed with 05c, gdp, mg

Details for d7ew9a_

PDB Entry: 7ew9 (more details), 2.13 Å

PDB Description: gdp-bound kras g12d in complex with th-z816
PDB Compounds: (A:) Isoform 2B of GTPase KRas

SCOPe Domain Sequences for d7ew9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ew9a_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mteyklvvvgadgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag
qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl
psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke

SCOPe Domain Coordinates for d7ew9a_:

Click to download the PDB-style file with coordinates for d7ew9a_.
(The format of our PDB-style files is described here.)

Timeline for d7ew9a_:

  • d7ew9a_ is new in SCOPe 2.08-stable