Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (81 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein automated matches [190047] (37 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186768] (291 PDB entries) |
Domain d7ew9a_: 7ew9 A: [421827] Other proteins in same PDB: d7ew9b2 automated match to d5us4a_ complexed with 05c, gdp, mg |
PDB Entry: 7ew9 (more details), 2.13 Å
SCOPe Domain Sequences for d7ew9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ew9a_ c.37.1.8 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mteyklvvvgadgvgksaltiqliqnhfvdeydptiedsyrkqvvidgetclldildtag qeeysamrdqymrtgegflcvfainntksfedihhyreqikrvkdsedvpmvlvgnkcdl psrtvdtkqaqdlarsygipfietsaktrqgvddafytlvreirkhke
Timeline for d7ew9a_: