![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily) contains mixed beta-sheet |
![]() | Superfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) ![]() |
![]() | Family d.165.1.1: Plant cytotoxins [56372] (18 proteins) |
![]() | Protein Bryodin [56375] (1 species) |
![]() | Species Red briony (Bryonia dioica) [TaxId:3652] [56376] (1 PDB entry) |
![]() | Domain d1bryy_: 1bry Y: [42181] |
PDB Entry: 1bry (more details), 2.1 Å
SCOPe Domain Sequences for d1bryy_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bryy_ d.165.1.1 (Y:) Bryodin {Red briony (Bryonia dioica) [TaxId: 3652]} dvsfrlsgatttsygvfiknlrealpyerkvynipllrssisgsgrytllhltnyadeti svavdvtnvyimgylagdvsyffneasateaakfvfkdakkkvtlpysgnyerlqtaagk ireniplglpaldsaittlyyytassaasallvliqstaesarykfieqqigkrvdktfl pslatislennwsalskqiqiastnngqfespvvlidgnnqrvsitnasarvvtsniall lnrnnia
Timeline for d1bryy_: