Lineage for d1bryy_ (1bry Y:)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.165: Ribosome inactivating proteins (RIP) [56370] (1 superfamily)
contains mixed beta-sheetSuperfamily d.165.1: Ribosome inactivating proteins (RIP) [56371] (3 families) 
Family d.165.1.1: Plant cytotoxins [56372] (18 proteins) 
Protein Bryodin [56375] (1 species) Species Red briony (Bryonia dioica) [TaxId:3652] [56376] (1 PDB entry) 
Domain d1bryy_: 1bry Y: [42181]
Details for d1bryy_
PDB Entry: 1bry (more details), 2.1 Å
PDB Description: bryodin type i rip
PDB Compounds: (Y:) bryodin ISCOPe Domain Sequences for d1bryy_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bryy_ d.165.1.1 (Y:) Bryodin {Red briony (Bryonia dioica) [TaxId: 3652]}
dvsfrlsgatttsygvfiknlrealpyerkvynipllrssisgsgrytllhltnyadeti
svavdvtnvyimgylagdvsyffneasateaakfvfkdakkkvtlpysgnyerlqtaagk
ireniplglpaldsaittlyyytassaasallvliqstaesarykfieqqigkrvdktfl
pslatislennwsalskqiqiastnngqfespvvlidgnnqrvsitnasarvvtsniall
lnrnnia
SCOPe Domain Coordinates for d1bryy_:
Click to download the PDB-style file with coordinates for d1bryy_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bryy_:
- d1bryy_ first appeared (with stable ids) in SCOP 1.55
- d1bryy_ appears in SCOPe 2.07
View in 3D
