Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d7ew2s_: 7ew2 S: [421783] Other proteins in same PDB: d7ew2b1, d7ew2b2, d7ew2c_ automated match to d5f72t_ complexed with j89 |
PDB Entry: 7ew2 (more details), 3.1 Å
SCOPe Domain Sequences for d7ew2s_:
Sequence, based on SEQRES records: (download)
>d7ew2s_ b.1.1.0 (S:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vqlvesggglvqpggsrklscsasgfafssfgmhwvrqapekglewvayissgsgtiyya dtvkgrftisrddpkntlflqmtslrsedtamyycvrsiyyygsspfdfwgqgttltvss ggggsggggsggggsdivmtqatssvpvtpgesvsiscrssksllhsngntylywflqrp gqspqlliyrmsnlasgvpdrfsgsgsgtaftltisrleaedvgvyycmqhleypltfga gtklel
>d7ew2s_ b.1.1.0 (S:) automated matches {Human (Homo sapiens) [TaxId: 9606]} vqlvesggglvqpggsrklscsasgfafssfgmhwvrqapekglewvayissgsgtiyya dtvkgrftisrddpkntlflqmtslrsedtamyycvrsiyyygsspfdfwgqgttltvss sdivmtqatssvpvtpgesvsiscrssksllhsngntylywflqrpgqspqlliyrmsnl asgvpdrfsgsgsgtaftltisrleaedvgvyycmqhleypltfgagtklel
Timeline for d7ew2s_: