Lineage for d7eqdp_ (7eqd P:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3021592Fold f.3: Light-harvesting complex subunits [56917] (1 superfamily)
    membrane all-alpha fold
  4. 3021593Superfamily f.3.1: Light-harvesting complex subunits [56918] (2 families) (S)
  5. 3021656Family f.3.1.0: automated matches [254203] (1 protein)
    not a true family
  6. 3021657Protein automated matches [254444] (10 species)
    not a true protein
  7. 3085400Species Rhodospirillum rubrum [TaxId:269796] [421717] (1 PDB entry)
  8. 3085450Domain d7eqdp_: 7eqd P: [421767]
    Other proteins in same PDB: d7eqd1_, d7eqd3_, d7eqd5_, d7eqd7_, d7eqd9_, d7eqda_, d7eqdd_, d7eqdf_, d7eqdi_, d7eqdk_, d7eqdl_, d7eqdm_, d7eqdo_, d7eqdq_, d7eqds_, d7eqdu_, d7eqdw_, d7eqdy_
    automated match to d1wrga_
    complexed with 07d, 08i, cdl, crt, fe, lmt, pef, pgv, rq0, u10

Details for d7eqdp_

PDB Entry: 7eqd (more details), 2.76 Å

PDB Description: structure of photosynthetic lh1-rc super-complex of rhodospirillum rubrum
PDB Compounds: (P:) Light-harvesting protein B-870 beta chain

SCOPe Domain Sequences for d7eqdp_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7eqdp_ f.3.1.0 (P:) automated matches {Rhodospirillum rubrum [TaxId: 269796]}
tegeakefhkiftssilvffgvaafahllvwiwrpwvpgpngys

SCOPe Domain Coordinates for d7eqdp_:

Click to download the PDB-style file with coordinates for d7eqdp_.
(The format of our PDB-style files is described here.)

Timeline for d7eqdp_:

  • d7eqdp_ is new in SCOPe 2.08-stable