Lineage for d7evye_ (7evy E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 3084149Species Mus musculus [TaxId:10090] [420466] (16 PDB entries)
  8. 3085447Domain d7evye_: 7evy E: [421764]
    Other proteins in same PDB: d7evyb1, d7evyb2, d7evyc_
    automated match to d5f72t_
    complexed with j8c, nag

Details for d7evye_

PDB Entry: 7evy (more details), 2.98 Å

PDB Description: cryo-em structure of siponimod -bound sphingosine-1-phosphate receptor 1 in complex with gi protein
PDB Compounds: (E:) scFv16

SCOPe Domain Sequences for d7evye_:

Sequence, based on SEQRES records: (download)

>d7evye_ b.1.1.0 (E:) automated matches {Mus musculus [TaxId: 10090]}
vqlvesggglvqpggsrklscsasgfafssfgmhwvrqapekglewvayissgsgtiyya
dtvkgrftisrddpkntlflqmtslrsedtamyycvrsiyyygsspfdfwgqgttltvss
ggggsggggsggggsdivmtqatssvpvtpgesvsiscrssksllhsngntylywflqrp
gqspqlliyrmsnlasgvpdrfsgsgsgtaftltisrleaedvgvyycmqhleypltfga
gtklel

Sequence, based on observed residues (ATOM records): (download)

>d7evye_ b.1.1.0 (E:) automated matches {Mus musculus [TaxId: 10090]}
vqlvesggglvqpggsrklscsasgfafssfgmhwvrqapekglewvayissgsgtiyya
dtvkgrftisrddpkntlflqmtslrsedtamyycvrsiyyygsspfdfwgqgttltvss
sdivmtqatssvpvtpgesvsiscrssksllhsngntylywflqrpgqspqlliyrmsnl
asgvpdrfsgsgsgtaftltisrleaedvgvyycmqhleypltfgagtklel

SCOPe Domain Coordinates for d7evye_:

Click to download the PDB-style file with coordinates for d7evye_.
(The format of our PDB-style files is described here.)

Timeline for d7evye_:

  • d7evye_ is new in SCOPe 2.08-stable