Lineage for d1mhdb_ (1mhd B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2557723Fold d.164: SMAD MH1 domain [56365] (1 superfamily)
    consists of four alpha-helices and three beta-ribbons
  4. 2557724Superfamily d.164.1: SMAD MH1 domain [56366] (2 families) (S)
  5. 2557725Family d.164.1.1: SMAD MH1 domain [56367] (2 proteins)
  6. 2557726Protein SMAD MH1 domain [56368] (1 species)
  7. 2557727Species Human (Homo sapiens) [TaxId:9606] [56369] (2 PDB entries)
  8. 2557731Domain d1mhdb_: 1mhd B: [42176]
    protein/DNA complex

Details for d1mhdb_

PDB Entry: 1mhd (more details), 2.8 Å

PDB Description: crystal structure of a smad mh1 domain bound to dna
PDB Compounds: (B:) smad3

SCOPe Domain Sequences for d1mhdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mhdb_ d.164.1.1 (B:) SMAD MH1 domain {Human (Homo sapiens) [TaxId: 9606]}
pivkrllgwkkgeqngqeekwcekavkslvkklkktgqldelekaittqnvntkcitipr
sldgrlqvshrkglphviycrlwrwpdlhshhelramelcefafnmkkdevcvnpyhyqr
vet

SCOPe Domain Coordinates for d1mhdb_:

Click to download the PDB-style file with coordinates for d1mhdb_.
(The format of our PDB-style files is described here.)

Timeline for d1mhdb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1mhda_