Lineage for d1a41__ (1a41 -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 37061Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
  4. 37062Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 37095Family d.163.1.2: Eukaryotic DNA topoisomerase I, catalytic core [56361] (1 protein)
  6. 37096Protein Eukaryotic DNA topoisomerase I, catalytic core [56362] (2 species)
  7. 37102Species Vaccinia virus [TaxId:10245] [56364] (1 PDB entry)
  8. 37103Domain d1a41__: 1a41 - [42174]

Details for d1a41__

PDB Entry: 1a41 (more details), 2.3 Å

PDB Description: type 1-topoisomerase catalytic fragment from vaccinia virus

SCOP Domain Sequences for d1a41__:

Sequence, based on SEQRES records: (download)

>d1a41__ d.163.1.2 (-) Eukaryotic DNA topoisomerase I, catalytic core {Vaccinia virus}
nakrdrifvrvynvmkrincfinknikksstdsnyqlavfmlmetmffirfgkmkylken
etvglltlknkhieispdeivikfvgkdkvshefvvhksnrlykpllkltddsspeeflf
nklserkvyecikqfgirikdlrtygvnytflynfwtnvksisplpspkklialtikqta
evvghtpsiskraymattilemvkdknfldvvskttfdeflsivvdhvks

Sequence, based on observed residues (ATOM records): (download)

>d1a41__ d.163.1.2 (-) Eukaryotic DNA topoisomerase I, catalytic core {Vaccinia virus}
nakrdrifvrvynvmkrincfinknikksstdsnyqlavfmlmetmffkenetvglltlk
nkhieispdeivikfvgkdkvshefvvhksnrlykpllkltddsspeeflfnklserkvy
ecikqfgirikdlrtygvnytflynfwtnvksisplpspkklialtikqtaevvghtpsi
skraymattilemvkdknfldvvskttfdeflsivvdhvks

SCOP Domain Coordinates for d1a41__:

Click to download the PDB-style file with coordinates for d1a41__.
(The format of our PDB-style files is described here.)

Timeline for d1a41__: