Lineage for d1a41a_ (1a41 A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
    core: alpha3-beta3-alpha4; one side of beta-sheet is exposed
  4. Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. Family d.163.1.2: Eukaryotic DNA topoisomerase I, catalytic core [56361] (1 protein)
  6. Protein Eukaryotic DNA topoisomerase I, catalytic core [56362] (2 species)
  7. Species Vaccinia virus [TaxId:10245] [56364] (1 PDB entry)
  8. Domain d1a41a_: 1a41 A: [42174]
    complexed with so4

Details for d1a41a_

PDB Entry: 1a41 (more details), 2.3 Å

PDB Description: type 1-topoisomerase catalytic fragment from vaccinia virus
PDB Compounds: (A:) topoisomerase I

SCOPe Domain Sequences for d1a41a_:

Sequence, based on SEQRES records: (download)

>d1a41a_ d.163.1.2 (A:) Eukaryotic DNA topoisomerase I, catalytic core {Vaccinia virus [TaxId: 10245]}
nakrdrifvrvynvmkrincfinknikksstdsnyqlavfmlmetmffirfgkmkylken
etvglltlknkhieispdeivikfvgkdkvshefvvhksnrlykpllkltddsspeeflf
nklserkvyecikqfgirikdlrtygvnytflynfwtnvksisplpspkklialtikqta
evvghtpsiskraymattilemvkdknfldvvskttfdeflsivvdhvks

Sequence, based on observed residues (ATOM records): (download)

>d1a41a_ d.163.1.2 (A:) Eukaryotic DNA topoisomerase I, catalytic core {Vaccinia virus [TaxId: 10245]}
nakrdrifvrvynvmkrincfinknikksstdsnyqlavfmlmetmffkenetvglltlk
nkhieispdeivikfvgkdkvshefvvhksnrlykpllkltddsspeeflfnklserkvy
ecikqfgirikdlrtygvnytflynfwtnvksisplpspkklialtikqtaevvghtpsi
skraymattilemvkdknfldvvskttfdeflsivvdhvks

SCOPe Domain Coordinates for d1a41a_ are not available.

Timeline for d1a41a_: