Lineage for d1a36a2 (1a36 A:431-633,A:713-765)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2557600Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
    core: alpha3-beta3-alpha4; one side of beta-sheet is exposed
  4. 2557601Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 2557703Family d.163.1.2: Eukaryotic DNA topoisomerase I, catalytic core [56361] (1 protein)
  6. 2557704Protein Eukaryotic DNA topoisomerase I, catalytic core [56362] (2 species)
  7. 2557705Species Human (Homo sapiens) [TaxId:9606] [56363] (15 PDB entries)
    Uniprot P11387 203-765 ! Uniprot P11387 203-767
  8. 2557712Domain d1a36a2: 1a36 A:431-633,A:713-765 [42173]
    Other proteins in same PDB: d1a36a1, d1a36a3
    protein/DNA complex

Details for d1a36a2

PDB Entry: 1a36 (more details), 2.8 Å

PDB Description: topoisomerase i/dna complex
PDB Compounds: (A:) topoisomerase I

SCOPe Domain Sequences for d1a36a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a36a2 d.163.1.2 (A:431-633,A:713-765) Eukaryotic DNA topoisomerase I, catalytic core {Human (Homo sapiens) [TaxId: 9606]}
pssrikgekdwqkyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalrag
nekeegetadtvgccslrvehinlhpeldgqeyvvefdflgkdsiryynkvpvekrvfkn
lqlfmenkqpeddlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapde
nipakilsynranravailcnhqXqialgtsklnfldpritvawckkwgvpiekiynktq
rekfawaidmadedyef

SCOPe Domain Coordinates for d1a36a2:

Click to download the PDB-style file with coordinates for d1a36a2.
(The format of our PDB-style files is described here.)

Timeline for d1a36a2: