Lineage for d1ej9a1 (1ej9 A:431-633,A:714-765)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1047274Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
    core: alpha3-beta3-alpha4; one side of beta-sheet is exposed
  4. 1047275Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 1047364Family d.163.1.2: Eukaryotic DNA topoisomerase I, catalytic core [56361] (1 protein)
  6. 1047365Protein Eukaryotic DNA topoisomerase I, catalytic core [56362] (2 species)
  7. 1047366Species Human (Homo sapiens) [TaxId:9606] [56363] (15 PDB entries)
    Uniprot P11387 203-765 ! Uniprot P11387 203-767
  8. 1047371Domain d1ej9a1: 1ej9 A:431-633,A:714-765 [42172]
    Other proteins in same PDB: d1ej9a2
    protein/DNA complex

Details for d1ej9a1

PDB Entry: 1ej9 (more details), 2.6 Å

PDB Description: crystal structure of human topoisomerase i dna complex
PDB Compounds: (A:) DNA topoisomerase I

SCOPe Domain Sequences for d1ej9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ej9a1 d.163.1.2 (A:431-633,A:714-765) Eukaryotic DNA topoisomerase I, catalytic core {Human (Homo sapiens) [TaxId: 9606]}
pssrikgekdwqkyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalrag
nekeegetadtvgccslrvehinlhpeldgqeyvvefdflgkdsiryynkvpvekrvfkn
lqlfmenkqpeddlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapde
nipakilsynranravailcnhqXialgtsklnfldpritvawckkwgvpiekiynktqr
ekfawaidmadedyef

SCOPe Domain Coordinates for d1ej9a1:

Click to download the PDB-style file with coordinates for d1ej9a1.
(The format of our PDB-style files is described here.)

Timeline for d1ej9a1: