Lineage for d1ej9a1 (1ej9 A:431-633,A:714-765)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 37061Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
  4. 37062Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 37095Family d.163.1.2: Eukaryotic DNA topoisomerase I, catalytic core [56361] (1 protein)
  6. 37096Protein Eukaryotic DNA topoisomerase I, catalytic core [56362] (2 species)
  7. 37097Species Human (Homo sapiens) [TaxId:9606] [56363] (4 PDB entries)
  8. 37100Domain d1ej9a1: 1ej9 A:431-633,A:714-765 [42172]
    Other proteins in same PDB: d1ej9a2

Details for d1ej9a1

PDB Entry: 1ej9 (more details), 2.6 Å

PDB Description: crystal structure of human topoisomerase i dna complex

SCOP Domain Sequences for d1ej9a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ej9a1 d.163.1.2 (A:431-633,A:714-765) Eukaryotic DNA topoisomerase I, catalytic core {Human (Homo sapiens)}
pssrikgekdwqkyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalrag
nekeegetadtvgccslrvehinlhpeldgqeyvvefdflgkdsiryynkvpvekrvfkn
lqlfmenkqpeddlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapde
nipakilsynranravailcnhqXialgtsklnfldpritvawckkwgvpiekiynktqr
ekfawaidmadedyef

SCOP Domain Coordinates for d1ej9a1:

Click to download the PDB-style file with coordinates for d1ej9a1.
(The format of our PDB-style files is described here.)

Timeline for d1ej9a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ej9a2