Lineage for d1a35a1 (1a35 A:431-635,A:713-765)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 85334Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
  4. 85335Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 85368Family d.163.1.2: Eukaryotic DNA topoisomerase I, catalytic core [56361] (1 protein)
  6. 85369Protein Eukaryotic DNA topoisomerase I, catalytic core [56362] (2 species)
  7. 85370Species Human (Homo sapiens) [TaxId:9606] [56363] (4 PDB entries)
  8. 85372Domain d1a35a1: 1a35 A:431-635,A:713-765 [42171]
    Other proteins in same PDB: d1a35a2

Details for d1a35a1

PDB Entry: 1a35 (more details), 2.5 Å

PDB Description: human topoisomerase i/dna complex

SCOP Domain Sequences for d1a35a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a35a1 d.163.1.2 (A:431-635,A:713-765) Eukaryotic DNA topoisomerase I, catalytic core {Human (Homo sapiens)}
pssrikgekdwqkyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalrag
nekeegetadtvgccslrvehinlhpeldgqeyvvefdflgkdsiryynkvpvekrvfkn
lqlfmenkqpeddlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapde
nipakilsynranravailcnhqraXqialgtsklnfldpritvawckkwgvpiekiynk
tqrekfawaidmadedyef

SCOP Domain Coordinates for d1a35a1:

Click to download the PDB-style file with coordinates for d1a35a1.
(The format of our PDB-style files is described here.)

Timeline for d1a35a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a35a2