![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily) core: alpha3-beta3-alpha4; one side of beta-sheet is exposed |
![]() | Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) ![]() |
![]() | Family d.163.1.2: Eukaryotic DNA topoisomerase I, catalytic core [56361] (1 protein) |
![]() | Protein Eukaryotic DNA topoisomerase I, catalytic core [56362] (2 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [56363] (15 PDB entries) |
![]() | Domain d1a31a1: 1a31 A:431-626,A:720-765 [42170] Other proteins in same PDB: d1a31a2 protein/DNA complex; complexed with 5iu |
PDB Entry: 1a31 (more details), 2.1 Å
SCOP Domain Sequences for d1a31a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1a31a1 d.163.1.2 (A:431-626,A:720-765) Eukaryotic DNA topoisomerase I, catalytic core {Human (Homo sapiens) [TaxId: 9606]} pssrikgekdwqkyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalrag nekeegetadtvgccslrvehinlhpeldgqeyvvefdflgkdsiryynkvpvekrvfkn lqlfmenkqpeddlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapde nipakilsynranravXklnyldpritvawckkwgvpiekiynktqrekfawaidmaded yef
Timeline for d1a31a1: