Lineage for d1a31a1 (1a31 A:431-626,A:720-765)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 264081Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
    core: alpha3-beta3-alpha4; one side of beta-sheet is exposed
  4. 264082Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 264123Family d.163.1.2: Eukaryotic DNA topoisomerase I, catalytic core [56361] (1 protein)
  6. 264124Protein Eukaryotic DNA topoisomerase I, catalytic core [56362] (2 species)
  7. 264125Species Human (Homo sapiens) [TaxId:9606] [56363] (7 PDB entries)
  8. 264127Domain d1a31a1: 1a31 A:431-626,A:720-765 [42170]
    Other proteins in same PDB: d1a31a2
    protein/DNA complex; complexed with 5iu

Details for d1a31a1

PDB Entry: 1a31 (more details), 2.1 Å

PDB Description: human reconstituted dna topoisomerase i in covalent complex with a 22 base pair dna duplex

SCOP Domain Sequences for d1a31a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a31a1 d.163.1.2 (A:431-626,A:720-765) Eukaryotic DNA topoisomerase I, catalytic core {Human (Homo sapiens)}
pssrikgekdwqkyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalrag
nekeegetadtvgccslrvehinlhpeldgqeyvvefdflgkdsiryynkvpvekrvfkn
lqlfmenkqpeddlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapde
nipakilsynranravXklnyldpritvawckkwgvpiekiynktqrekfawaidmaded
yef

SCOP Domain Coordinates for d1a31a1:

Click to download the PDB-style file with coordinates for d1a31a1.
(The format of our PDB-style files is described here.)

Timeline for d1a31a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1a31a2