Lineage for d1a31a1 (1a31 A:431-626,A:720-765)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2999834Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
    core: alpha3-beta3-alpha4; one side of beta-sheet is exposed
  4. 2999835Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 2999937Family d.163.1.2: Eukaryotic DNA topoisomerase I, catalytic core [56361] (1 protein)
  6. 2999938Protein Eukaryotic DNA topoisomerase I, catalytic core [56362] (2 species)
  7. 2999939Species Human (Homo sapiens) [TaxId:9606] [56363] (15 PDB entries)
    Uniprot P11387 203-765 ! Uniprot P11387 203-767
  8. 2999941Domain d1a31a1: 1a31 A:431-626,A:720-765 [42170]
    Other proteins in same PDB: d1a31a2
    protein/DNA complex

Details for d1a31a1

PDB Entry: 1a31 (more details), 2.1 Å

PDB Description: human reconstituted dna topoisomerase i in covalent complex with a 22 base pair dna duplex
PDB Compounds: (A:) protein (topoisomerase I)

SCOPe Domain Sequences for d1a31a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1a31a1 d.163.1.2 (A:431-626,A:720-765) Eukaryotic DNA topoisomerase I, catalytic core {Human (Homo sapiens) [TaxId: 9606]}
pssrikgekdwqkyetarrlkkcvdkirnqyredwkskemkvrqravalyfidklalrag
nekeegetadtvgccslrvehinlhpeldgqeyvvefdflgkdsiryynkvpvekrvfkn
lqlfmenkqpeddlfdrlntgilnkhlqdlmegltakvfrtynasitlqqqlkeltapde
nipakilsynranravXklnyldpritvawckkwgvpiekiynktqrekfawaidmaded
yef

SCOPe Domain Coordinates for d1a31a1:

Click to download the PDB-style file with coordinates for d1a31a1.
(The format of our PDB-style files is described here.)

Timeline for d1a31a1: