Lineage for d1floc2 (1flo C:137-423)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2605773Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
    core: alpha3-beta3-alpha4; one side of beta-sheet is exposed
  4. 2605774Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 2605775Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (6 proteins)
  6. 2605826Protein Flp recombinase [56359] (1 species)
  7. 2605827Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56360] (3 PDB entries)
  8. 2605834Domain d1floc2: 1flo C:137-423 [42168]
    Other proteins in same PDB: d1floa1, d1flob1, d1floc1, d1flod1
    protein/DNA complex; complexed with phs

Details for d1floc2

PDB Entry: 1flo (more details), 2.65 Å

PDB Description: FLP Recombinase-Holliday Junction Complex I
PDB Compounds: (C:) flp recombinase

SCOPe Domain Sequences for d1floc2:

Sequence, based on SEQRES records: (download)

>d1floc2 d.163.1.1 (C:137-423) Flp recombinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nshskkmlkallsegesiweitekilnsfeytsrftktktlyqflflatfincgrfsdik
nvdpksfklvqnkylgviiqclvtetktsvsrhiyffsargridplvyldeflrnsepvl
krvnrtgnsssnkqeyqllkdnlvrsynkalkknapysifaikngpkshigrhlmtsfls
mkglteltnvvgnwsdkrasavarttythqitaipdhyfalvsryyaydpiskemialkd
etnpieewqhieqlkgsaegsirypawngiisqevldylssyinrri

Sequence, based on observed residues (ATOM records): (download)

>d1floc2 d.163.1.1 (C:137-423) Flp recombinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
nshskkmlkallsegesiweitekilnsfeytsrftktktlyqflflatfincgrfsdik
nvdpksfklvqnkylgviiqclvtetktsvsrhiyffsargridplvyldeflrnsepvl
krvnrtgnkqeyqllkdnlvrsynkalkknapysifaikngpkshigrhlmtsflsmkgl
teltnvvgnwsdkrasavarttythqitaipdhyfalvsryyaydpiskemialkdetnp
ieewqhieqsirypawngiisqevldylssyinrri

SCOPe Domain Coordinates for d1floc2:

Click to download the PDB-style file with coordinates for d1floc2.
(The format of our PDB-style files is described here.)

Timeline for d1floc2: