SCOPe 2.05: Domain d5crxa2: 5crx A:130-340

Lineage for d5crxa2 (5crx A:130-340)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
   core: alpha3-beta3-alpha4; one side of beta-sheet is exposed

4. Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families)

5. Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (6 proteins)

6. Protein Cre recombinase [56355] (1 species)

7. Species Bacteriophage P1 [TaxId:10678] [56356] (20 PDB entries)
   Uniprot P06956 20-341

8. Domain d5crxa2: 5crx A:130-340 [42163]
   Other proteins in same PDB: d5crxa1, d5crxb1

Details for d5crxa2

PDB Entry: 5crx, 2.7 Å

PDB Description: asymmetric dna-bending in the cre-loxp site-specific recombination synapse

PDB Compounds: (A:) protein (bacteriophage p1 cre gene)

SCOPe Domain Sequences for d5crxa2:

Sequence, based on SEQRES records:

>d5crxa2 d.163.1.1 (A:130-340) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtd
ggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa
psatsqlstralegifeathrliygakddsgqrylawsghsarvgaardmaragvsipei
mqaggwtnvnivmnfirnldsetgamvrlle

Sequence, based on observed residues (ATOM records):

>d5crxa2 d.163.1.1 (A:130-340) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllriaeiarirvkdisrtd
ggrmekalslgvtklverwisvsgvaddpnnylfcrvrkngvaapsatsqlstralegif
eathrliygakddsgqrylawsghsarvgaardmaragvsipeimqaggwtrnldsetga
mvrlle

Timeline for d5crxa2:

• d5crxa2 first appeared (with stable ids) in SCOP 1.55
  
• d5crxa2 appears in SCOPe 2.04
  
• d5crxa2 appears in SCOPe 2.06
  
• d5crxa2 appears in the current release, SCOPe 2.08