SCOP 1.69: Domain d3crxb2: 3crx B:130-341

Lineage for d3crxb2 (3crx B:130-341)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
   core: alpha3-beta3-alpha4; one side of beta-sheet is exposed

4. Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families)

5. Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (5 proteins)

6. Protein Cre recombinase [56355] (1 species)

7. Species Bacteriophage P1 [TaxId:10678] [56356] (16 PDB entries)

8. Domain d3crxb2: 3crx B:130-341 [42162]
   Other proteins in same PDB: d3crxa1, d3crxb1

Details for d3crxb2

PDB Entry: 3crx, 2.5 Å

PDB Description: cre recombinase/dna complex intermediate i

SCOP Domain Sequences for d3crxb2:

Sequence; same for both SEQRES and ATOM records:

>d3crxb2 d.163.1.1 (B:130-341) Cre recombinase {Bacteriophage P1}
rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllkiaeiarirvkdisrtd
ggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa
psatsqlstralegifeathrliygakddsgqrylawsghsarvgaardmaragvsipei
mqaggwtnvnivmnyirnldsetgamvrlled

Timeline for d3crxb2:

• d3crxb2 first appeared (with stable ids) in SCOP 1.55
  
• d3crxb2 appears in SCOP 1.67
  
• d3crxb2 appears in SCOP 1.71
  
• d3crxb2 appears in the current release, SCOPe 2.08