![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily) core: alpha3-beta3-alpha4; one side of beta-sheet is exposed |
![]() | Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) ![]() |
![]() | Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (6 proteins) |
![]() | Protein Cre recombinase [56355] (1 species) |
![]() | Species Bacteriophage P1 [TaxId:10678] [56356] (20 PDB entries) Uniprot P06956 20-341 |
![]() | Domain d3crxa2: 3crx A:130-341 [42161] Other proteins in same PDB: d3crxa1, d3crxb1 protein/DNA complex |
PDB Entry: 3crx (more details), 2.5 Å
SCOPe Domain Sequences for d3crxa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3crxa2 d.163.1.1 (A:130-341) Cre recombinase {Bacteriophage P1 [TaxId: 10678]} rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllkiaeiarirvkdisrtd ggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa psatsqlstralegifeathrliygakddsgqrylawsghsarvgaardmaragvsipei mqaggwtnvnivmnyirnldsetgamvrlled
Timeline for d3crxa2: