| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily) core: alpha3-beta3-alpha4; one side of beta-sheet is exposed |
Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) ![]() |
| Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (6 proteins) |
| Protein Cre recombinase [56355] (1 species) |
| Species Bacteriophage P1 [TaxId:10678] [56356] (20 PDB entries) Uniprot P06956 20-341 |
| Domain d4crxb2: 4crx B:130-341 [42156] Other proteins in same PDB: d4crxa1, d4crxb1 protein/DNA complex |
PDB Entry: 4crx (more details), 2.2 Å
SCOPe Domain Sequences for d4crxb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4crxb2 d.163.1.1 (B:130-341) Cre recombinase {Bacteriophage P1 [TaxId: 10678]}
rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllkiaeiarirvkdisrtd
ggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa
psatsqlstralegifeathrliygakddsgqrylawsghsarvgaardmaragvsipei
mqaggwtnvnivmnyirnldsetgamvrlled
Timeline for d4crxb2: