SCOPe 2.08: Domain d7e6lb_: 7e6l B:

Lineage for d7e6lb_ (7e6l B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.0: automated matches [191364] (1 protein)
   not a true family

6. Protein automated matches [190438] (36 species)
   not a true protein

7. Species Human coronavirus nl63 [TaxId:277944] [421509] (5 PDB entries)

8. Domain d7e6lb_: 7e6l B: [421552]
   automated match to d6w81a_

Details for d7e6lb_

PDB Entry: 7e6l, 1.78 Å

PDB Description: crystal structure of hcov-nl63 3c-like protease,ph5.0

PDB Compounds: (B:) 3C-like proteinase

SCOPe Domain Sequences for d7e6lb_:

Sequence; same for both SEQRES and ATOM records:

>d7e6lb_ b.47.1.0 (B:) automated matches {Human coronavirus nl63 [TaxId: 277944]}
glkkmaqpsgcvercvvrvcygstvlngvwlgdtvtcprhviapsttvlidydhaystmr
lhnfsvshngvflgvvgvtmhgsvlrikvsqsnvhtpkhvfktlkpgdsfnilacyegia
sgvfgvnlrtnftikgsfingacgspgynvrndgtvefcylhqielgsgahvgsdftgsv
ygnfddqpslqvesanlmlsdnvvaflyaallngcrwwlcstrvnvdgfnewamangyts
vssvecysilaaktgvsveqllasiqhlhegfggknilgysslcdeftlaevvkqmygv

Timeline for d7e6lb_:

• d7e6lb_ is new in SCOPe 2.08-stable