Lineage for d4crxa2 (4crx A:130-341)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 420830Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
    core: alpha3-beta3-alpha4; one side of beta-sheet is exposed
  4. 420831Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 420832Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (5 proteins)
  6. 420833Protein Cre recombinase [56355] (1 species)
  7. 420834Species Bacteriophage P1 [TaxId:10678] [56356] (16 PDB entries)
  8. 420836Domain d4crxa2: 4crx A:130-341 [42155]
    Other proteins in same PDB: d4crxa1, d4crxb1

Details for d4crxa2

PDB Entry: 4crx (more details), 2.2 Å

PDB Description: asymmetric dna-bending in the cre-loxp site-specific recombination synapse

SCOP Domain Sequences for d4crxa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4crxa2 d.163.1.1 (A:130-341) Cre recombinase {Bacteriophage P1}
rakqalafertdfdqvrslmensdrcqdirnlaflgiayntllkiaeiarirvkdisrtd
ggrmlihigrtktlvstagvekalslgvtklverwisvsgvaddpnnylfcrvrkngvaa
psatsqlstralegifeathrliygakddsgqrylawsghsarvgaardmaragvsipei
mqaggwtnvnivmnyirnldsetgamvrlled

SCOP Domain Coordinates for d4crxa2:

Click to download the PDB-style file with coordinates for d4crxa2.
(The format of our PDB-style files is described here.)

Timeline for d4crxa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4crxa1