Lineage for d1aihd_ (1aih D:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1047274Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
    core: alpha3-beta3-alpha4; one side of beta-sheet is exposed
  4. 1047275Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 1047276Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (5 proteins)
  6. 1047341Protein Integrase [56351] (1 species)
  7. 1047342Species Bacteriophage HP1 [TaxId:10690] [56352] (1 PDB entry)
  8. 1047346Domain d1aihd_: 1aih D: [42152]
    complexed with mg, so4

Details for d1aihd_

PDB Entry: 1aih (more details), 2.5 Å

PDB Description: catalytic domain of bacteriophage hp1 integrase
PDB Compounds: (D:) hp1 integrase

SCOPe Domain Sequences for d1aihd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aihd_ d.163.1.1 (D:) Integrase {Bacteriophage HP1 [TaxId: 10690]}
etelaflyerdiyrllaecdnsrnpdlglivriclatgarwseaetltqsqvmpykitft
ntkskknrtvpisdelfdmlpkkrgrlfndayesfenavlraeielpkgqlthvlrhtfa
shfmmnggnilvlkeilghstiemtmryahfapshlesavkfnplsnpaq

SCOPe Domain Coordinates for d1aihd_:

Click to download the PDB-style file with coordinates for d1aihd_.
(The format of our PDB-style files is described here.)

Timeline for d1aihd_: