Lineage for d1aihc_ (1aih C:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 336358Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
    core: alpha3-beta3-alpha4; one side of beta-sheet is exposed
  4. 336359Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families) (S)
  5. 336360Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (5 proteins)
  6. 336393Protein Integrase [56351] (1 species)
  7. 336394Species Bacteriophage HP1 [TaxId:10690] [56352] (1 PDB entry)
  8. 336397Domain d1aihc_: 1aih C: [42151]

Details for d1aihc_

PDB Entry: 1aih (more details), 2.5 Å

PDB Description: catalytic domain of bacteriophage hp1 integrase

SCOP Domain Sequences for d1aihc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aihc_ d.163.1.1 (C:) Integrase {Bacteriophage HP1}
elaflyerdiyrllaecdnsrnpdlglivriclatgarwseaetltqsqvmpykitftnt
kskknrtvpisdelfdmlpkkrgrlfndayesfenavlraeielpkgqlthvlrhtfash
fmmnggnilvlkeilghstiemtmryahfapshlesavkfnplsnpaq

SCOP Domain Coordinates for d1aihc_:

Click to download the PDB-style file with coordinates for d1aihc_.
(The format of our PDB-style files is described here.)

Timeline for d1aihc_: