SCOPe 2.07: Domain d1aihb_: 1aih B:

Lineage for d1aihb_ (1aih B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.163: DNA breaking-rejoining enzymes [56348] (1 superfamily)
   core: alpha3-beta3-alpha4; one side of beta-sheet is exposed

4. Superfamily d.163.1: DNA breaking-rejoining enzymes [56349] (2 families)

5. Family d.163.1.1: Lambda integrase-like, catalytic core [56350] (6 proteins)

6. Protein Integrase [56351] (1 species)

7. Species Bacteriophage HP1 [TaxId:10690] [56352] (1 PDB entry)

8. Domain d1aihb_: 1aih B: [42150]
   complexed with mg, so4

Details for d1aihb_

PDB Entry: 1aih, 2.5 Å

PDB Description: catalytic domain of bacteriophage hp1 integrase

PDB Compounds: (B:) hp1 integrase

SCOPe Domain Sequences for d1aihb_:

Sequence; same for both SEQRES and ATOM records:

>d1aihb_ d.163.1.1 (B:) Integrase {Bacteriophage HP1 [TaxId: 10690]}
elaflyerdiyrllaecdnsrnpdlglivriclatgarwseaetltqsqvmpykitftnt
kskknrtvpisdelfdmlpkkrgrlfndayesfenavlraeielpkgqlthvlrhtfash
fmmnggnilvlkeilghstiemtmryahfapshlesavkfnplsnpaq

Timeline for d1aihb_:

• d1aihb_ first appeared (with stable ids) in SCOP 1.55
  
• d1aihb_ appears in SCOPe 2.06
  
• d1aihb_ appears in the current release, SCOPe 2.08